PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang09g03190.1
Common NameLR48_Vigan05g159400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB_related
Protein Properties Length: 84aa    MW: 9261.34 Da    PI: 9.1662
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang09g03190.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding34.74.3e-113475245
                     SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                       ++++E+ l+++  k+ G++ W++Ia +++ gRt+ ++  +w 
   Vang09g03190.1 34 VEFSEDEETLIIRMYKLVGKR-WSLIAGRIP-GRTADEIEKYWT 75
                     679******************.*********.***********6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.2762882IPR017930Myb domain
SMARTSM007177.3E-103280IPR001005SANT/Myb domain
SuperFamilySSF466896.94E-103379IPR009057Homeodomain-like
PfamPF002494.6E-103475IPR001005SANT/Myb domain
CDDcd001678.11E-83578No hitNo description
Gene3DG3DSA:1.10.10.601.1E-143578IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 84 aa     Download sequence    Send to blast
MADSNTSSTQ TSSHSSVKDD KICLDSGKRG SSKVEFSEDE ETLIIRMYKL VGKRWSLIAG  60
RIPGRTADEI EKYWTSRLSS SSK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP2381141e-76KP238114.1 Lablab purpureus caprice and triptychon-like enhancer transcript variant X1 (etcl1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014499558.15e-40PREDICTED: auxin-responsive protein IAA33-like
SwissprotQ9LNI51e-17ETC1_ARATH; MYB-like transcription factor ETC1
TrEMBLA0A0L9UN911e-53A0A0L9UN91_PHAAN; Uncharacterized protein
STRINGGLYMA12G32130.34e-36(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF26923178
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46410.14e-18MYB_related family protein
Publications ? help Back to Top
  1. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]